PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10023279m
Common NameCICLE_v10023279mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family B3
Protein Properties Length: 109aa    MW: 12377.4 Da    PI: 10.3427
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10023279mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B344.62.6e-14381032794
                      ---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
               B3  27 ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                      g + ++ k ++l+d++ r W v +    +sg  vlt+GW+ F kan+++ gD ++F +++ se  + v
  Ciclev10023279m  38 GRSRTQRKVVVLRDPDMRMWPVLY--HERSGFKVLTSGWEAFSKANNIQPGDGCIFGVESYSESIYGV 103
                      444567889***************..******************************976655554555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019367.46E-152797IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.2E-143097IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.08231108IPR003340B3 DNA binding domain
PfamPF023622.9E-113798IPR003340B3 DNA binding domain
CDDcd100173.20E-114491No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MKYYISNKAV VQRICKSFHL LPRALELSTC LPTSSFRGRS RTQRKVVVLR DPDMRMWPVL  60
YHERSGFKVL TSGWEAFSKA NNIQPGDGCI FGVESYSESI YGVSIVRK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006440022.11e-76hypothetical protein CICLE_v10023279mg
TrEMBLV4TIS51e-76V4TIS5_9R
STRINGVIT_17s0000g10080.t016e-32(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1853758